| Link type | Probability | Chain B piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
| view details |
|
Unlink | 82% | -666C +808C -863C +917C | |||||||||
Chain B Sequence |
DEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS---SVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDF |
Chain B Sequence |
IQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFL |
| sequence length | 336,327 |
| structure length | 333,327 |
| publication title |
Mechanism for the allosteric regulation of phosphodiesterase 2A deduced from the X-ray structure of a near full-length construct.
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | cGMP-dependent 3',5'-cyclic phosphodiesterase |
| source organism | Homo sapiens |
| missing residues | B: 720-724 |
| ec nomenclature |
ec 3.1.4.17: 3',5'-cyclic-nucleotide phosphodiesterase. ec 3.1.4.17: 3',5'-cyclic-nucleotide phosphodiesterase. |
| pdb deposition date | 2009-08-28 |
| LinkProt deposition date | 2016-10-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| BC | PF00233 | PDEase_I | 3'5'-cyclic nucleotide phosphodiesterase |
| BC | PF00233 | PDEase_I | 3'5'-cyclic nucleotide phosphodiesterase |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b | ||
| Mainly Alpha | Orthogonal Bundle | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b | Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b |
#chains in the LinkProt database with same CATH superfamily 3ITU BC; 3ITU BCD; 3ITU ABC; 3ITU ABCD; 3ITU ACD; 3ITU BD; 3ITU AB; 3ITU ABD; 3ITU CD; 3ITU AD; #chains in the LinkProt database with same CATH topology 3ITU BC; 3ITU BCD; 3ITU ABC; 3ITU ABCD; 3ITU ACD; 3ITU BD; 3ITU AB; 3ITU ABD; 3ITU CD; 3ITU AD; #chains in the LinkProt database with same CATH homology 3ITU BC; 3ITU BCD; 3ITU ABC; 3ITU ABCD; 3ITU ACD; 3ITU BD; 3ITU AB; 3ITU ABD; 3ITU CD; 3ITU AD;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...