| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 58% | +317A -363A | |||||||||
| view details |
|
Unlink | 58% | +317A -363A | |||||||||
| view details |
|
Unlink | 58% | +317A -363A | |||||||||
| view details |
|
Unlink | 58% | +317A -363A | |||||||||
Chain A Sequence |
KPFANTKKTLENQVEELTEKCSLKTDEFLKAKEKINEIFEKLNTIRDEVIKKKNQNEYYR |
Chain A Sequence |
DVSQKIKDIDDQIQQLLLKQRHLLSKMASSMKSLKNCQKELISTQILQFEAQNMDVSMNDVIGFFNEREADLK |
| sequence length | 60,73 |
| structure length | 60,73 |
| publication title |
Structural and functional insights into the roles of the Mms21 subunit of the Smc5/6 complex.
pubmed doi rcsb |
| molecule tags | Recombination/replication/ligase |
| molecule keywords | Structural maintenance of chromosomes protein 5 |
| source organism | Saccharomyces cerevisiae |
| pdb deposition date | 2009-06-11 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF02463 | SMC_N | RecF/RecN/SMC N terminal domain |
| AB | PF02463 | SMC_N | RecF/RecN/SMC N terminal domain |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
