3GJPABC

Crystal structure of mutant coiled coil gcn4 leucine zipper
Link type Probability Chain A piercings Chain B piercings Chain C piercings
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
view details
Unlink Unlink 42% -22C +33C -23C +33C -8A +32A
Interpreting sequences
Chain A Sequence
GSRMKQLEDKVEELLSKNYHLENEIARIKKLVGER
Chain A Sequence
GSRMKQLEDKVEELLSKNYHLENEIARIKKLVGER
Chain A Sequence
GSRMKQLEDKVEELLSKNYHLENEIARIKKLVGE
sequence length 35,35,34
structure length 35,35,34
publication title Molecular basis of coiled-coil oligomerization-state specificity
pubmed doi rcsb
molecule tags Transcription
molecule keywords General control protein GCN4
source organism Saccharomyces cerevisiae
pdb deposition date2009-03-09
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABC PF07716 bZIP_2Basic region leucine zipper
ABC PF07716 bZIP_2Basic region leucine zipper
ABC PF07716 bZIP_2Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling