| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
| view details |
|
Unlink | 53% | -86B +96B -119B +131B | -119A +131A | ||||||||
Chain A Sequence |
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
Chain A Sequence |
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS |
| sequence length | 57,57 |
| structure length | 57,57 |
| publication title |
Intertwined dimeric structure for the SH3 domain of the c-Src tyrosine kinase induced by polyethylene glycol binding
pubmed doi rcsb |
| molecule tags | Transferase |
| molecule keywords | Proto-oncogene tyrosine-protein kinase Src |
| source organism | Gallus gallus |
| ec nomenclature |
ec 2.7.10.2: Non-specific protein-tyrosine kinase. ec 2.7.10.2: Non-specific protein-tyrosine kinase. |
| pdb deposition date | 2008-12-14 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00018 | SH3_1 | SH3 domain |
| AB | PF00018 | SH3_1 | SH3 domain |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
