| Link type | Probability | Chain H piercings | Chain S piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 52% | +346S -378S | |||||||||
| view details |
|
Unlink | 52% | +346S -378S | |||||||||
| view details |
|
Unlink | 52% | +346S -378S | |||||||||
| view details |
|
Unlink | 52% | +346S -378S | |||||||||
Chain H Sequence |
SHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEE |
Chain H Sequence |
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNE |
| sequence length | 98,77 |
| structure length | 98,77 |
| publication title |
Hybrid Structural Model of the Complete Human ESCRT-0 Complex.
pubmed doi rcsb |
| molecule tags | Protein binding |
| molecule keywords | Hepatocyte growth factor-regulated tyrosine kinase substrate |
| source organism | Homo sapiens |
| pdb deposition date | 2008-10-28 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| HS | PF12210 | Hrs_helical | Hepatocyte growth factor-regulated tyrosine kinase substrate |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
