| Link type | Probability | Chain B piercings | Chain C piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
| view details |
|
Hopf.2 U Ring | 26% | +247B -264B -299B -209D -260D +297D | ||||||||||
Chain B Sequence |
TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVV |
Chain B Sequence |
TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVR |
Chain B Sequence |
TTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVR |
| sequence length | 100,101,101 |
| structure length | 100,101,101 |
| publication title |
C-terminal domain of SARS-CoV main protease can form a 3D domain-swapped dimer
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | Replicase polyprotein 1ab |
| source organism | Sars coronavirus |
| ec nomenclature |
ec 2.7.7.48: RNA-directed RNA polymerase. ec 3.4.19.12: Ubiquitinyl hydrolase 1. ec 3.4.22.69: SARS coronavirus main proteinase. ec 3.6.4.12: DNA helicase. ec 3.6.4.13: RNA helicase. ec 2.7.7.48: RNA-directed RNA polymerase. ec 3.4.19.12: Ubiquitinyl hydrolase 1. ec 3.4.22.69: SARS coronavirus main proteinase. ec 3.6.4.12: DNA helicase. ec 3.6.4.13: RNA helicase. ec 2.7.7.48: RNA-directed RNA polymerase. ec 3.4.19.12: Ubiquitinyl hydrolase 1. ec 3.4.22.69: SARS coronavirus main proteinase. ec 3.6.4.12: DNA helicase. ec 3.6.4.13: RNA helicase. |
| pdb deposition date | 2008-08-28 |
| LinkProt deposition date | 2016-10-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| BCD | PF05409 | Peptidase_C30 | Coronavirus endopeptidase C30 |
| BCD | PF05409 | Peptidase_C30 | Coronavirus endopeptidase C30 |
| BCD | PF05409 | Peptidase_C30 | Coronavirus endopeptidase C30 |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | main proteinase (3clpro) structure, domain 3 | main proteinase (3clpro) structure, domain 3 | ||
| Mainly Alpha | Orthogonal Bundle | main proteinase (3clpro) structure, domain 3 | main proteinase (3clpro) structure, domain 3 | ||
| Mainly Alpha | Orthogonal Bundle | main proteinase (3clpro) structure, domain 3 | main proteinase (3clpro) structure, domain 3 |
#chains in the LinkProt database with same CATH superfamily 3EBN AB; 3EBN BD; 3EBN AC; 3EBN ABCD; 3EBN ABC; 3EBN BC; 3EBN BCD; 3EBN ACD; 3EBN AD; 3EBN CD; 3EBN ABD; #chains in the LinkProt database with same CATH topology 3EBN AB; 3EBN BD; 3EBN AC; 3EBN ABCD; 3EBN ABC; 3EBN BC; 3EBN BCD; 3EBN ACD; 3EBN AD; 3EBN CD; 3EBN ABD; #chains in the LinkProt database with same CATH homology 3EBN AB; 3EBN BD; 3EBN AC; 3EBN ABCD; 3EBN ABC; 3EBN BC; 3EBN BCD; 3EBN ACD; 3EBN AD; 3EBN CD; 3EBN ABD;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
