| Link type | Probability | Chain D piercings | Chain G piercings | Chain I piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
| view details |
|
Hopf.2 U Ring | 36% | -492D -124I | ||||||||||
Chain D Sequence |
TENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTP |
Chain D Sequence |
TENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTP |
Chain D Sequence |
GSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIE |
| sequence length | 35,35,83 |
| structure length | 35,35,83 |
| publication title |
Molecular architecture of native HIV-1 gp120 trimers.
pubmed doi rcsb |
| molecule tags | Viral protein |
| molecule keywords | HIV-1 envelope glycoprotein gp120 |
| source organism | Hiv-1 m:b_hxb2r |
| pdb deposition date | 2008-07-02 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| DGI | PF00516 | GP120 | Envelope glycoprotein GP120 |
| DGI | PF00516 | GP120 | Envelope glycoprotein GP120 |
| DGI | PF00516 | GP120 | Envelope glycoprotein GP120 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
