| Link type | Probability | Loop ranges | N loop piercings | C loop piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Solomon.1 | 100% | 29-175A, 176-263A | -218 -252 | -142 -165 | ||||||||
Chain A Sequence |
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH |
| sequence length | 258 |
| structure length | 258 |
| publication title |
Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb |
| molecule tags | Cell adhesion |
| molecule keywords | FLOCCULATION PROTEIN FLO5 |
| source organism | Saccharomyces cerevisiae |
| pdb deposition date | 2010-07-06 |
| LinkProt deposition date | 2016-08-17 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
