| Link type | Probability | Chain A piercings | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
| view details |
|
Hopf.1 U Ring | 49% | +72A -95A +31D -92D | +95A +91B | |||||||||
Chain A Sequence |
GMASLKEIIDELGKQAKEQNKIASRIMKIKGIKRIVVQLNAVPQDGKIRYSMTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYV |
Chain A Sequence |
GMASLKEIIDELGKQAKEQNKIASRIMKIKGIKRIVVQLNAVPQDGKIRYSMTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYV |
Chain A Sequence |
MASLKEIIDELGKQAKEQNKIASRIMKIKGIKRIVVQLNAVPQDGKIRYSMTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYVKFT |
| sequence length | 92,92,94 |
| structure length | 92,92,94 |
| publication title |
The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb |
| molecule tags | Viral protein |
| molecule keywords | ORF 131 |
| source organism | Sulfolobus islandicus rudivirus 1 |
| pdb deposition date | 2010-02-08 |
| LinkProt deposition date | 2016-10-29 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
