2X5HABCD

Crystal structure of the orf131 l26m l51m double mutant from sulfolobus islandicus rudivirus 1
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
view details
Other Other 30% +43D -38A +53A +92A +83C +94C +40D +62D +73A +64B
Interpreting sequences
Chain A Sequence
GMASLKEIIDELGKQAKEQNKIASRIMKIKGIKRIVVQLNAVPQDGKIRYSMTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYV
Chain A Sequence
GMASLKEIIDELGKQAKEQNKIASRIMKIKGIKRIVVQLNAVPQDGKIRYSMTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYV
Chain A Sequence
ASLKEIIDELGKQAKEQNKIASRIMKIKGIKRIVVQLNAVPQDGKIRYSMTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYVKFT
Chain A Sequence
MASLKEIIDELGKQAKEQNKIASRIMKIKGIKRIVVQLNAVPQDGKIRYSMTIHSQNNFRKQIGITPQDAEDLKLIAEFLEKYSDFLNEYVKFT
sequence length 92,92,93,94
structure length 92,92,93,94
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords ORF 131
source organism Sulfolobus islandicus rudivirus 1
pdb deposition date2010-02-08
LinkProt deposition date2016-10-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling