| Link type | Probability | Chain H piercings | Chain V piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 52% | -364V +439V | +335H -375H | ||||||||
| view details |
|
Unlink | 52% | -364V +439V | +335H -375H | ||||||||
| view details |
|
Unlink | 52% | -364V +439V | +335H -375H | ||||||||
| view details |
|
Unlink | 52% | -364V +439V | +335H -375H | ||||||||
Chain H Sequence |
KEAIVFSQKTTIDQLHNSLNAASKTGNSNEVLQDPHIGDMYGSVTPLRPQVTRMLGKYAKEKEDMLSLRQVLANAERSYNQLMDRAAN |
Chain H Sequence |
VDLSDEEKDSIYMFASLVEKMKSRPLNEILEDSKLQNLAQRVFASKARLNYALNDKAQKYNTLIEMNGKISEIMNIYDRLLEQQLQSINLS |
| sequence length | 88,91 |
| structure length | 88,91 |
| publication title |
The Vps27/Hse1 Complex Is a GAT Domain-Based Scaffold for Ubiquitin-Dependent Sorting.
pubmed doi rcsb |
| molecule tags | Endocytosis/exocytosis |
| molecule keywords | Uncharacterized protein YHL002W |
| source organism | Saccharomyces cerevisiae |
| pdb deposition date | 2007-04-16 |
| LinkProt deposition date | 2016-10-29 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
