| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
| view details |
|
Hopf.2 | 48% | -106B +129B -161B | +65A -76A -83A | ||||||||
Chain A Sequence |
MIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSLE |
Chain A Sequence |
MIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSLE |
| sequence length | 83,83 |
| structure length | 83,83 |
| publication title |
Domain-swapped Dimerization of the Second PDZ Domain of ZO2 May Provide a Structural Basis for the Polymerization of Claudins
pubmed doi rcsb |
| molecule tags | Cell adhesion |
| molecule keywords | Tight junction protein ZO-2 |
| source organism | Homo sapiens |
| pdb deposition date | 2007-02-05 |
| LinkProt deposition date | 2016-10-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00595 | PDZ | PDZ domain (Also known as DHR or GLGF) |
| AB | PF00595 | PDZ | PDZ domain (Also known as DHR or GLGF) |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | Pdz3 Domain | Pdz3 Domain | ||
| Mainly Beta | Roll | Pdz3 Domain | Pdz3 Domain |
#chains in the LinkProt database with same CATH superfamily 3CYY ABC; 3CYY ABCD; 3CYY ACD; 3CYY BC; 3CYY AD; 2OSG AB; 3CYY ABD; 3CYY AB; 3CYY BCD; 3CYY AC; 3CYY BD; 2RCZ AB; #chains in the LinkProt database with same CATH topology 3CYY ABC; 3CYY ABCD; 3CYY ACD; 3CYY BC; 3CYY AD; 2OSG AB; 3CYY ABD; 3CYY AB; 3CYY BCD; 3CYY AC; 3CYY BD; 2RCZ AB; #chains in the LinkProt database with same CATH homology 3CYY ABC; 3CYY ABCD; 3CYY ACD; 3CYY BC; 3CYY AD; 2OSG AB; 3CYY ABD; 3CYY AB; 3CYY BCD; 3CYY AC; 3CYY BD; 2RCZ AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...