| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 49% | +45B +87B -107B | +41A -51A +106A | ||||||||
| view details |
|
Hopf.1 | 49% | +45B +87B -107B | +41A -51A +106A | ||||||||
| view details |
|
Hopf.1 | 49% | +45B +87B -107B | +41A -51A +106A | ||||||||
| view details |
|
Hopf.1 | 49% | +45B +87B -107B | +41A -51A +106A | ||||||||
| view details |
|
Hopf.1 | 49% | +45B +87B -107B | +41A -51A +106A | ||||||||
| view details |
|
Hopf.1 | 49% | +45B +87B -107B | +41A -51A +106A | ||||||||
| view details |
|
Hopf.1 | 49% | +45B +87B -107B | +41A -51A +106A | ||||||||
| view details |
|
Hopf.1 | 49% | +45B +87B -107B | +41A -51A +106A | ||||||||
Chain A Sequence |
SESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLE |
Chain A Sequence |
MEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLE |
| sequence length | 93,98 |
| structure length | 93,98 |
| publication title |
Monomer/dimer transition of the caspase-recruitment domain of human Nod1
pubmed doi rcsb |
| molecule tags | Apoptosis |
| molecule keywords | Caspase recruitment domain-containing protein 4 |
| source organism | Homo sapiens |
| pdb deposition date | 2006-11-22 |
| LinkProt deposition date | 2016-10-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00619 | CARD | Caspase recruitment domain |
| AB | PF00619 | CARD | Caspase recruitment domain |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
