| Link type | Probability | Loop ranges | N loop piercings | C loop piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 | 100% | 24-51A, 52-69A | -57 | -45 | ||||||||
Chain A Sequence |
GDKEECTVPIGWSEPVKGLCKARFTRYYCMGNCCKVYEGCYTGGYSRMGECARNCPG |
| sequence length | 57 |
| structure length | 57 |
| publication title |
Oxidative folding and structural analyses of a kunitz-related inhibitor and its disulfide intermediates: functional implications.
pubmed doi rcsb |
| molecule tags | Hydrolase inhibitor |
| molecule keywords | Tryptase inhibitor |
| source organism | Rhipicephalus appendiculatus |
| pdb deposition date | 2011-07-06 |
| LinkProt deposition date | 2016-08-17 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
