| Link type | Probability | Loop ranges | N loop piercings | C loop piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Hopf.1 | 100% | 20-57A, 60-115A | +75 | +45 | ||||||||
Chain A Sequence |
VSISYDPIYAADLSMGSVACSNGDHGLMAQYPTLGEVPGFPNVGGIPDIAGWDSPSCGTCWKVTIPNGNSIFIRGVDSGRGGFNVNPTAFTKLVGSTEAGRVDNVNYVQVDLSNCINGAN |
| sequence length | 120 |
| structure length | 120 |
| publication title |
The solution structure of the fungal elicitor Cerato-Platanin
rcsb |
| molecule tags | Toxin |
| molecule keywords | Cerato-platanin |
| source organism | Ceratocystis platani |
| pdb deposition date | 2009-11-03 |
| LinkProt deposition date | 2016-08-17 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...