2HZKABD

Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its open form
Link type Probability Chain A piercings Chain B piercings Chain D piercings
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
view details
Hopf.1 U Ring Hopf.1 U Ring 30% +345B -365B -291D +365D +173A +366D
Interpreting sequences
Chain A Sequence
VTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Chain A Sequence
PKVTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
Chain A Sequence
SAPKVTWRLASSFPKSLDTIFGGAEVLSKMLSEATDGNFQIQVFSAGELVPGLQAADAVTEGTVECCHTVGYYYWGKDPTFALAAAVPFSLSARGINAWHYHGGGIDLYNEFLSQHNIVAFPGGNTGVQMGGWFRREINTVADMQGLKMRVGGFAGKVMERLGVVPQQIAGGDIYPALEKGTIDATEWVGPYDDEKLGFFKVAPYYYYPGWWEGGPTVHFMFNKSAYEGLTPTYQSLLRTACHAADANMLQLYDWKNPTAIKSLVAQGTQLRPFSPEILQACFEAANEVYAEMEASNPAFKKIWDSIKAFRSEHYTWAQIAEYNYDTFMMVQQNAGKL
sequence length 334,336,338
structure length 334,336,338
publication title Crystal structures of an Extracytoplasmic Solute Receptor from a TRAP transporter in its open and closed forms reveal a helix-swapped dimer requiring a cation for alpha-keto acid binding.
pubmed doi rcsb
molecule tags Ligand binding, transport protein
molecule keywords TRAP-T family sorbitol/mannitol transporter, periplasmic bin
source organism Rhodobacter sphaeroides 2.4.1
pdb deposition date2006-08-09
LinkProt deposition date2016-10-29

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABD PF03480 DctPBacterial extracellular solute-binding protein, family 7
ABD PF03480 DctPBacterial extracellular solute-binding protein, family 7
ABD PF03480 DctPBacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling