| Link type | Probability | Chain H piercings | Chain M piercings | Chain N piercings | Chain P piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
| view details |
|
Other | 33% | +40P -122P | +121H +121H +121H +121H +90M +101M +105M +120M | ||||||||||
Chain H Sequence |
SDLVTKFESLIISKYPVSF--------AQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEIN |
Chain H Sequence |
MSDLVTKFESLII--YPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEI |
Chain H Sequence |
MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEI |
Chain H Sequence |
MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVSTLYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEI |
| sequence length | 119,119,119,119 |
| structure length | 111,117,119,119 |
| publication title |
Structures of the interacting domains from yeast glutamyl-tRNA synthetase and tRNA-aminoacylation and nuclear-export cofactor Arc1p reveal a novel function for an old fold.
pubmed doi rcsb |
| molecule tags | Biosynthetic protein, rna binding |
| molecule keywords | GU4 nucleic-binding protein 1 |
| source organism | Saccharomyces cerevisiae |
| missing residues | H: 22-31 M: 15-18 |
| pdb deposition date | 2006-07-19 |
| LinkProt deposition date | 2016-10-30 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
