| Link type | Probability | Chain B piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 90% | +36B -98B | |||||||||
| view details |
|
Unlink | 90% | +36B -98B | |||||||||
| view details |
|
Unlink | 90% | +36B -98B | |||||||||
| view details |
|
Unlink | 90% | +36B -98B | |||||||||
Chain B Sequence |
PLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF |
Chain B Sequence |
EEY |
| sequence length | 72,3 |
| structure length | 72,3 |
| publication title |
Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb |
| molecule tags | Structural protein |
| molecule keywords | Dynactin-1 |
| source organism | Homo sapiens |
| pdb deposition date | 2006-07-06 |
| LinkProt deposition date | 2016-10-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| BC | PF01302 | CAP_GLY | CAP-Gly domain |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. |
#chains in the LinkProt database with same CATH superfamily 2HL3 BC; 2HKN AB; 2HL3 AC; 2HL3 ABC; 2HL3 AB; #chains in the LinkProt database with same CATH topology 1OV3 AD; 1OV3 BCD; 2HL3 BC; 1OV3 ABC; 3H6Z BM; 2HL3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 2HL3 AC; 2HL3 AB; 1OV3 AC; 1OV3 AB; 3H6Z AL; 2HKN AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB; #chains in the LinkProt database with same CATH homology 2HL3 BC; 3H6Z BM; 2HL3 AC; 2HL3 ABC; 2HL3 AB; 3H6Z AL; 2HKN AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
