Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A | ||||||||
view details |
![]() |
Solomon.1 | 43% | -35B -44B +60B -88B | +21A -36A -94A -98A |
Chain A Sequence |
SHMS------PLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF |
Chain A Sequence |
PLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF |
sequence length | 82,72 |
structure length | 76,72 |
publication title |
Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb |
molecule tags | Structural protein |
molecule keywords | Dynactin-1 |
source organism | Homo sapiens |
missing residues | A: 19-26 |
pdb deposition date | 2006-07-06 |
LinkProt deposition date | 2016-10-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
AB | PF01302 | CAP_GLY | CAP-Gly domain |
AB | PF01302 | CAP_GLY | CAP-Gly domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. | ||
Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. |
#chains in the LinkProt database with same CATH superfamily 2HL3 BC; 2HKN AB; 2HL3 AC; 2HL3 ABC; 2HL3 AB; #chains in the LinkProt database with same CATH topology 1OV3 AD; 1OV3 BCD; 2HL3 BC; 1OV3 ABC; 3H6Z BM; 2HL3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 2HL3 AC; 2HL3 AB; 1OV3 AC; 1OV3 AB; 3H6Z AL; 2HKN AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB; #chains in the LinkProt database with same CATH homology 2HL3 BC; 3H6Z BM; 2HL3 AC; 2HL3 ABC; 2HL3 AB; 3H6Z AL; 2HKN AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...