| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
| view details |
|
Hopf.2 | 65% | -39B | -67A | ||||||||
Chain A Sequence |
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL |
Chain A Sequence |
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL |
| sequence length | 66,66 |
| structure length | 66,66 |
| publication title |
Common mode of DNA binding to cold shock domains. Crystal structure of hexathymidine bound to the domain-swapped form of a major cold shock protein from Bacillus caldolyticus.
pubmed doi rcsb |
| molecule tags | Gene regulation/dna |
| molecule keywords | 5'-D(*TP*TP*TP*TP*TP*T)-3' |
| source organism | Bacillus caldolyticus |
| pdb deposition date | 2006-06-13 |
| LinkProt deposition date | 2016-10-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00313 | CSD | 'Cold-shock' DNA-binding domain |
| AB | PF00313 | CSD | 'Cold-shock' DNA-binding domain |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
