| Link type | Probability | Chain A piercings | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
| view details |
|
Hopf.1 U Ring | 32% | +51B +86D | +205A -219A | |||||||||
Chain A Sequence |
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
Chain A Sequence |
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
Chain A Sequence |
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF |
| sequence length | 206,206,206 |
| structure length | 206,206,206 |
| publication title |
Crystal Structures of Human NUDT5 Reveal Insights into the Structural Basis of the Substrate Specificity
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | ADP-sugar pyrophosphatase |
| source organism | Homo sapiens |
| ec nomenclature |
ec 3.6.1.13: ADP-ribose diphosphatase. ec 3.6.1.58: 8-oxo-dGDP phosphatase. ec 3.6.1.13: ADP-ribose diphosphatase. ec 3.6.1.58: 8-oxo-dGDP phosphatase. ec 3.6.1.13: ADP-ribose diphosphatase. ec 3.6.1.58: 8-oxo-dGDP phosphatase. |
| pdb deposition date | 2006-06-28 |
| LinkProt deposition date | 2016-10-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| ABD | PF00293 | NUDIX | NUDIX domain |
| ABD | PF00293 | NUDIX | NUDIX domain |
| ABD | PF00293 | NUDIX | NUDIX domain |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
