Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
view details |
![]() |
Hopf.2 | 59% | -13B -70B +86B | -62A |
Chain A Sequence |
MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEVL |
Chain A Sequence |
MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEVL |
sequence length | 86,86 |
structure length | 86,86 |
publication title |
X-ray structure of a domain-swapped dimer of Ser46-phosphorylated Crh from Bacillus subtilis.
pubmed doi rcsb |
molecule tags | Transport protein |
molecule keywords | HPr-like protein crh |
source organism | Bacillus subtilis |
pdb deposition date | 2005-08-03 |
LinkProt deposition date | 2016-10-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
AB | PF00381 | PTS-HPr | PTS HPr component phosphorylation site |
AB | PF00381 | PTS-HPr | PTS HPr component phosphorylation site |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Histidine-containing Protein; Chain: A; | Histidine-containing Protein; Chain: A; | ||
Alpha Beta | 2-Layer Sandwich | Histidine-containing Protein; Chain: A; | Histidine-containing Protein; Chain: A; |
#chains in the LinkProt database with same CATH superfamily 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC; #chains in the LinkProt database with same CATH topology 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC; #chains in the LinkProt database with same CATH homology 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...