| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
| view details |
|
Hopf.2 | 59% | -13B -70B +86B | -62A | ||||||||
Chain A Sequence |
MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEVL |
Chain A Sequence |
MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEVL |
| sequence length | 86,86 |
| structure length | 86,86 |
| publication title |
X-ray structure of a domain-swapped dimer of Ser46-phosphorylated Crh from Bacillus subtilis.
pubmed doi rcsb |
| molecule tags | Transport protein |
| molecule keywords | HPr-like protein crh |
| source organism | Bacillus subtilis |
| pdb deposition date | 2005-08-03 |
| LinkProt deposition date | 2016-10-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00381 | PTS-HPr | PTS HPr component phosphorylation site |
| AB | PF00381 | PTS-HPr | PTS HPr component phosphorylation site |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Histidine-containing Protein; Chain: A; | Histidine-containing Protein; Chain: A; | ||
| Alpha Beta | 2-Layer Sandwich | Histidine-containing Protein; Chain: A; | Histidine-containing Protein; Chain: A; |
#chains in the LinkProt database with same CATH superfamily 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC; #chains in the LinkProt database with same CATH topology 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC; #chains in the LinkProt database with same CATH homology 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...