| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
| view details |
|
Hopf.1 | 53% | +111B | +14A +115A -139A | ||||||||
Chain A Sequence |
SVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQ |
Chain A Sequence |
SVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQ |
| sequence length | 134,127 |
| structure length | 134,127 |
| publication title |
Amino-terminal Dimerization, NRDP1-Rhodanese Interaction, and Inhibited Catalytic Domain Conformation of the Ubiquitin-specific Protease 8 (USP8).
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | Ubiquitin carboxyl-terminal hydrolase 8 |
| source organism | Homo sapiens |
| ec nomenclature |
ec 3.4.19.12: Ubiquitinyl hydrolase 1. ec 3.4.19.12: Ubiquitinyl hydrolase 1. |
| pdb deposition date | 2005-07-12 |
| LinkProt deposition date | 2016-10-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF08969 | USP8_dimer | USP8 dimerisation domain |
| AB | PF08969 | USP8_dimer | USP8 dimerisation domain |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
