2A50BC

Fluorescent protein asfp595, wt, off-state
Link type Probability Chain B piercings Chain C piercings
view details
Unlink Unlink 90% +92B +155B -175B -233B
view details
Unlink Unlink 90% +92B +155B -175B -233B
view details
Unlink Unlink 90% +92B +155B -175B -233B
view details
Unlink Unlink 90% +92B +155B -175B -233B
view details
Unlink Unlink 90% +92B +155B -175B -233B
view details
Unlink Unlink 90% +92B +155B -175B -233B
view details
Unlink Unlink 90% +92B +155B -175B -233B
Interpreting sequences
Chain B Sequence
SKTFIKYVSGIPDYFKQSFPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKAGRWEPATEIVYEVDGVLRGQSLMALKCPGGRHLTCHLHTTYRSKKPASALKMPGFHFEDHRIEIMEEVEKGKCYKQYEAAVGRYCDAAPSKLGHN
Chain B Sequence
FLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
sequence length 167,59
structure length 167,59
publication title Structure and mechanism of the reversible photoswitch of a fluorescent protein
pubmed doi rcsb
molecule tags Luminescent protein
molecule keywords GFP-like non-fluorescent chromoprotein FP595 chain 1
source organism Anemonia sulcata
pdb deposition date2005-06-30
LinkProt deposition date2016-10-30

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
BC PF01353 GFPGreen fluorescent protein
BC PF01353 GFPGreen fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green Fluorescent Protein 2a50B00
2A50ACD 2A50ABC 2A50BCD 2A50AD 2A50CD 2A50ABD 2A50BC 2A50AB 2A50BD 2A50ABCD
chains in the LinkProt database with same CATH superfamily
2A50ACD 2A50ABC 2A50BCD 2A50AD 2A50CD 2A50ABD 2A50BC 2A50AB 2A50BD 2A50ABCD
chains in the LinkProt database with same CATH topology
2A50ACD 2A50ABC 2A50BCD 2A50AD 2A50CD 2A50ABD 2A50BC 2A50AB 2A50BD 2A50ABCD
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 2A50 ACD;  2A50 ABC;  2A50 BCD;  2A50 AD;  2A50 CD;  2A50 ABD;  2A50 BC;  2A50 AB;  2A50 BD;  2A50 ABCD; 
#chains in the LinkProt database with same CATH topology
 2A50 ACD;  2A50 ABC;  2A50 BCD;  2A50 AD;  2A50 CD;  2A50 ABD;  2A50 BC;  2A50 AB;  2A50 BD;  2A50 ABCD; 
#chains in the LinkProt database with same CATH homology
 2A50 ACD;  2A50 ABC;  2A50 BCD;  2A50 AD;  2A50 CD;  2A50 ABD;  2A50 BC;  2A50 AB;  2A50 BD;  2A50 ABCD; 
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling