| Link type | Probability | Chain A piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Unlink | 88% | -106D +232D | -30A +40A | ||||||||
| view details |
|
Unlink | 88% | -106D +232D | -30A +40A | ||||||||
| view details |
|
Unlink | 88% | -106D +232D | -30A +40A | ||||||||
| view details |
|
Unlink | 88% | -106D +232D | -30A +40A | ||||||||
| view details |
|
Unlink | 88% | -106D +232D | -30A +40A | ||||||||
Chain A Sequence |
HGSASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC |
Chain A Sequence |
SKTFIKYVSGIPDYFKQSFPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKAGRWEPATEIVYEVDGVLRGQSLMALKCPGGRHLTCHLHTTYRSKKPASALKMPGFHFEDHRIEIMEEVEKGKCYKQYEAAVGRYCDAAPSKLGHN |
| sequence length | 64,167 |
| structure length | 64,167 |
| publication title |
Structure and mechanism of the reversible photoswitch of a fluorescent protein
pubmed doi rcsb |
| molecule tags | Luminescent protein |
| molecule keywords | GFP-like non-fluorescent chromoprotein FP595 chain 1 |
| source organism | Anemonia sulcata |
| pdb deposition date | 2005-06-30 |
| LinkProt deposition date | 2016-10-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AD | PF01353 | GFP | Green fluorescent protein |
| AD | PF01353 | GFP | Green fluorescent protein |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | Green Fluorescent Protein | Green Fluorescent Protein |
#chains in the LinkProt database with same CATH superfamily 2A50 ACD; 2A50 ABC; 2A50 BCD; 2A50 AD; 2A50 CD; 2A50 ABD; 2A50 BC; 2A50 AB; 2A50 BD; 2A50 ABCD; #chains in the LinkProt database with same CATH topology 2A50 ACD; 2A50 ABC; 2A50 BCD; 2A50 AD; 2A50 CD; 2A50 ABD; 2A50 BC; 2A50 AB; 2A50 BD; 2A50 ABCD; #chains in the LinkProt database with same CATH homology 2A50 ACD; 2A50 ABC; 2A50 BCD; 2A50 AD; 2A50 CD; 2A50 ABD; 2A50 BC; 2A50 AB; 2A50 BD; 2A50 ABCD;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...