| Link type | Probability | Loop ranges | N loop piercings | C loop piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 100% | 30-69A, 72-157A | +100 | +51 | ||||||||
Chain A Sequence |
NQKCSGNPRRYNGKSCASTTNYHDSHKGACGCGPASGDAQFGWNAGSFVAAASQMYFDSGNKGWCGQHCGQCIKLTTTGGYVPGQGGPVREGLSKTFMITNLCPNIYPNQDWCNQGSQYGGHNKYGYELHLDLENGRSQVTGMGWNNPETTWEVVNCDSEHNHDHRTPSNSMYGQCQCAH |
| sequence length | 180 |
| structure length | 180 |
| publication title |
The Crystal Structure of the Beta-1,4-D-Endoglucanase Cel45A from Blue Mussel Mytilus Edulis at 1.2A
rcsb |
| molecule tags | Hydrolase |
| molecule keywords | ENDOGLUCANASE |
| pdb deposition date | 2004-11-08 |
| LinkProt deposition date | 2016-08-17 |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
