Link type | Probability | Chain C piercings | Chain D piercings | Chain G piercings | Chain H piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H | |||||||||||
view details |
![]() |
Other | 34% | -951C -666D +951H |
Chain C Sequence |
QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKR---SSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ |
Chain C Sequence |
QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKR---SSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ |
Chain C Sequence |
ALLRYLLDK |
Chain C Sequence |
ALLRYLLDK |
sequence length | 250,250,9,9 |
structure length | 247,247,9,9 |
publication title |
The Three-dimensional Structures of Antagonistic and Agonistic Forms of the Glucocorticoid Receptor Ligand-binding Domain:
RU-486 INDUCES A TRANSCONFORMATION THAT LEADS TO ACTIVE ANTAGONISM.
pubmed doi rcsb |
molecule tags | Hormone receptor |
molecule keywords | Glucocorticoid receptor |
source organism | Homo sapiens |
missing residues | C: 704-708 D: 704-708 |
pdb deposition date | 2003-05-09 |
LinkProt deposition date | 2016-10-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
CDGH | PF00104 | Hormone_recep | Ligand-binding domain of nuclear hormone receptor |
CDGH | PF00104 | Hormone_recep | Ligand-binding domain of nuclear hormone receptor |
CDGH | PF16279 | DUF4927 | Domain of unknown function (DUF4927) |
CDGH | PF16279 | DUF4927 | Domain of unknown function (DUF4927) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Retinoid X Receptor | Retinoid X Receptor | ||
Mainly Alpha | Orthogonal Bundle | Retinoid X Receptor | Retinoid X Receptor |
#chains in the LinkProt database with same CATH superfamily 1P93 BCDF; 1P93 ACFH; 1P93 ABH; 1P93 CH; 1P93 CDFH; 1P93 ADFG; 1P93 CG; 1P93 ABDH; 1P93 ADEG; 1P93 DGH; 1P93 ADEH; 1P93 AC; 1P93 DG; 1P93 ABCD; 1P93 ADE; 1P93 ABEG; 1P93 CDF; 1P93 ACDF; 1P93 CEG; 1P93 ACD; 1P93 BCEH; 1P93 ABDG; 1P93 BF; 1P93 ACDH; 1P93 CDE; 1P93 DH; 1P93 ACDE; 1P93 BC; 1P93 AE; 1P93 CDEG; 1P93 BCH; 1P93 BCF; 1P93 AEH; 1P93 BCFH; 1P93 BCDG; 1P93 ABFH; 1P93 BE; 1P93 ABFG; 1P93 ABF; 1P93 BCE; 1P93 ADFH; 1P93 CD; 1P93 CDGH; 1P93 ADEF; 1P93 ABEH; 1P93 ABCG; 1P93 CDFG; 1P93 ABCH; 1P93 ABEF; 1XIU AE; 1P93 AFGH; 1P93 ACE; 1P93 ABG; 1P93 AEFG; 1P93 ADG; 1P93 AEF; 1P93 CFG; 1P93 AF; 1P93 CDEF; 1P93 AEGH; 1P93 ACF; 1P93 CEFH; 1P93 BCEG; 1P93 BCGH; 1P93 AB; 1P93 ABGH; 1P93 CGH; 1P93 ACEF; 3FS1 AB; 1P93 BCD; 1P93 ABD; 1P93 CE; 1P93 BCDE; 1P93 ADGH; 1P93 BEF; 1P93 CFH; 1P93 BCDH; 1P93 AGH; 1P93 ACGH; 1P93 CEGH; 1P93 ABCF; 1P93 AH; 1P93 ABDE; 1XIU BF; 1P93 CF; 1P93 BCFG; 1P93 CFGH; 1P93 AFH; 1P93 ADH; 1P93 ACFG; 1P93 ABC; 1P93 CEH; 1P93 ABCE; 1P93 AD; 1P93 ADF; 1P93 AFG; 1P93 AEG; 1P93 CDG; 1P93 ACDG; 1P93 CEF; 1P93 CDH; 1P93 AG; 1P93 ACG; 1P93 CEFG; 1P93 AEFH; 1P93 BCG; 1P93 BCEF; 1P93 ABDF; 3GD2 AB; 1P93 ACEH; 1P93 ACEG; 1P93 ABE; 1P93 CDEH; 1P93 ACH; #chains in the LinkProt database with same CATH topology 1P93 BCDF; 1P93 ACFH; 1P93 ABH; 1P93 CH; 1P93 CDFH; 1P93 ADFG; 1P93 CG; 1P93 ABDH; 1P93 ADEG; 1P93 DGH; 1P93 ADEH; 1P93 AC; 1P93 DG; 1P93 ABCD; 1P93 ADE; 1P93 ABEG; 1P93 CDF; 1P93 ACDF; 1P93 CEG; 1P93 ACD; 1P93 BCEH; 1P93 ABDG; 1P93 BF; 1P93 ACDH; 1P93 CDE; 1P93 DH; 1P93 ACDE; 1P93 BC; 1P93 AE; 1P93 CDEG; 1P93 BCH; 1P93 BCF; 1P93 AEH; 1P93 BCFH; 1P93 BCDG; 1P93 ABFH; 1P93 BE; 1P93 ABFG; 1P93 ABF; 1P93 BCE; 1P93 ADFH; 1P93 CD; 1P93 CDGH; 1P93 ADEF; 1P93 ABEH; 1P93 ABCG; 1P93 CDFG; 1P93 ABCH; 1P93 ABEF; 1XIU AE; 1P93 AFGH; 1P93 ACE; 1P93 ABG; 1P93 AEFG; 1P93 ADG; 1P93 AEF; 1P93 CFG; 1P93 AF; 1P93 CDEF; 1P93 AEGH; 1P93 ACF; 1P93 CEFH; 1P93 BCEG; 1P93 BCGH; 1P93 AB; 1P93 ABGH; 1P93 CGH; 1P93 ACEF; 3FS1 AB; 1P93 BCD; 1P93 ABD; 1P93 CE; 1P93 BCDE; 1P93 ADGH; 1P93 BEF; 1P93 CFH; 1P93 BCDH; 1P93 AGH; 1P93 ACGH; 1P93 CEGH; 1P93 ABCF; 1P93 AH; 1P93 ABDE; 1XIU BF; 1P93 CF; 1P93 BCFG; 1P93 CFGH; 1P93 AFH; 1P93 ADH; 1P93 ACFG; 1P93 ABC; 1P93 CEH; 1P93 ABCE; 1P93 AD; 1P93 ADF; 1P93 AFG; 1P93 AEG; 1P93 CDG; 1P93 ACDG; 1P93 CEF; 1P93 CDH; 1P93 AG; 1P93 ACG; 1P93 CEFG; 1P93 AEFH; 1P93 BCG; 1P93 BCEF; 1P93 ABDF; 3GD2 AB; 1P93 ACEH; 1P93 ACEG; 1P93 ABE; 1P93 CDEH; 1P93 ACH; #chains in the LinkProt database with same CATH homology 1P93 BCDF; 1P93 ACFH; 1P93 ABH; 1P93 CH; 1P93 CDFH; 1P93 ADFG; 1P93 CG; 1P93 ABDH; 1P93 ADEG; 1P93 DGH; 1P93 ADEH; 1P93 AC; 1P93 DG; 1P93 ABCD; 1P93 ADE; 1P93 ABEG; 1P93 CDF; 1P93 ACDF; 1P93 CEG; 1P93 ACD; 1P93 BCEH; 1P93 ABDG; 1P93 BF; 1P93 ACDH; 1P93 CDE; 1P93 DH; 1P93 ACDE; 1P93 BC; 1P93 AE; 1P93 CDEG; 1P93 BCH; 1P93 BCF; 1P93 AEH; 1P93 BCFH; 1P93 BCDG; 1P93 ABFH; 1P93 BE; 1P93 ABFG; 1P93 ABF; 1P93 BCE; 1P93 ADFH; 1P93 CD; 1P93 CDGH; 1P93 ADEF; 1P93 ABEH; 1P93 ABCG; 1P93 CDFG; 1P93 ABCH; 1P93 ABEF; 1XIU AE; 1P93 AFGH; 1P93 ACE; 1P93 ABG; 1P93 AEFG; 1P93 ADG; 1P93 AEF; 1P93 CFG; 1P93 AF; 1P93 CDEF; 1P93 AEGH; 1P93 ACF; 1P93 CEFH; 1P93 BCEG; 1P93 BCGH; 1P93 AB; 1P93 ABGH; 1P93 CGH; 1P93 ACEF; 3FS1 AB; 1P93 BCD; 1P93 ABD; 1P93 CE; 1P93 BCDE; 1P93 ADGH; 1P93 BEF; 1P93 CFH; 1P93 BCDH; 1P93 AGH; 1P93 ACGH; 1P93 CEGH; 1P93 ABCF; 1P93 AH; 1P93 ABDE; 1XIU BF; 1P93 CF; 1P93 BCFG; 1P93 CFGH; 1P93 AFH; 1P93 ADH; 1P93 ACFG; 1P93 ABC; 1P93 CEH; 1P93 ABCE; 1P93 AD; 1P93 ADF; 1P93 AFG; 1P93 AEG; 1P93 CDG; 1P93 ACDG; 1P93 CEF; 1P93 CDH; 1P93 AG; 1P93 ACG; 1P93 CEFG; 1P93 AEFH; 1P93 BCG; 1P93 BCEF; 1P93 ABDF; 3GD2 AB; 1P93 ACEH; 1P93 ACEG; 1P93 ABE; 1P93 CDEH; 1P93 ACH;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...