| Link type | Probability | Chain B piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Unlink | 79% | -195B +284B | |||||||||
| view details |
|
Unlink | 79% | -195B +284B | |||||||||
| view details |
|
Unlink | 79% | -195B +284B | |||||||||
| view details |
|
Unlink | 79% | -195B +284B | |||||||||
| view details |
|
Unlink | 79% | -195B +284B | |||||||||
| view details |
|
Unlink | 79% | -195B +284B | |||||||||
| view details |
|
Unlink | 79% | -195B +284B | |||||||||
| view details |
|
Unlink | 79% | -195B +284B | |||||||||
Chain B Sequence |
SPEFIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPD-----EPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKS |
Chain B Sequence |
QPPSNPPPRPP |
| sequence length | 132,11 |
| structure length | 127,11 |
| publication title |
Molecular basis of phosphorylation-induced activation of the NADPH oxidase
pubmed doi rcsb |
| molecule tags | Oxidoreductase activator |
| molecule keywords | Neutrophil cytosol factor 1 |
| source organism | Homo sapiens |
| missing residues | B: 217-223 |
| pdb deposition date | 2003-03-25 |
| LinkProt deposition date | 2016-10-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| BD | PF00018 | SH3_1 | SH3 domain |
| BD | PF16621 | NECFESHC | SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1 |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | SH3 type barrels. | SH3 Domains | ||
| Mainly Beta | Roll | SH3 type barrels. | SH3 Domains |
#chains in the LinkProt database with same CATH superfamily 1OV3 AD; 1OV3 BCD; 1OV3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 1OV3 AC; 1OV3 AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB; #chains in the LinkProt database with same CATH topology 1OV3 AD; 1OV3 BCD; 2HL3 BC; 1OV3 ABC; 3H6Z BM; 2HL3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 2HL3 AC; 2HL3 AB; 1OV3 AC; 1OV3 AB; 3H6Z AL; 2HKN AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB; #chains in the LinkProt database with same CATH homology 1OV3 AD; 1OV3 BCD; 1OV3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 1OV3 AC; 1OV3 AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...