Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A | ||||||||
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A | ||||||||
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A | ||||||||
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A | ||||||||
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A | ||||||||
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A | ||||||||
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A | ||||||||
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A | ||||||||
view details |
![]() |
Hopf.2 | 58% | -166B +177B -198B | -206A +261A -284A |
Chain A Sequence |
LGSPEFIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKS |
Chain A Sequence |
SPEFIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPD-----EPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKS |
sequence length | 134,132 |
structure length | 134,127 |
publication title |
Molecular basis of phosphorylation-induced activation of the NADPH oxidase
pubmed doi rcsb |
molecule tags | Oxidoreductase activator |
molecule keywords | Neutrophil cytosol factor 1 |
source organism | Homo sapiens |
missing residues | B: 217-223 |
pdb deposition date | 2003-03-25 |
LinkProt deposition date | 2016-10-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
AB | PF00018 | SH3_1 | SH3 domain |
AB | PF16621 | NECFESHC | SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1 |
AB | PF00018 | SH3_1 | SH3 domain |
AB | PF16621 | NECFESHC | SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | SH3 type barrels. | SH3 Domains | ||
Mainly Beta | Roll | SH3 type barrels. | SH3 Domains | ||
Mainly Beta | Roll | SH3 type barrels. | SH3 Domains | ||
Mainly Beta | Roll | SH3 type barrels. | SH3 Domains |
#chains in the LinkProt database with same CATH superfamily 1OV3 AD; 1OV3 BCD; 1OV3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 1OV3 AC; 1OV3 AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB; #chains in the LinkProt database with same CATH topology 1OV3 AD; 1OV3 BCD; 2HL3 BC; 1OV3 ABC; 3H6Z BM; 2HL3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 2HL3 AC; 2HL3 AB; 1OV3 AC; 1OV3 AB; 3H6Z AL; 2HKN AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB; #chains in the LinkProt database with same CATH homology 1OV3 AD; 1OV3 BCD; 1OV3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 1OV3 AC; 1OV3 AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...