| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
| view details |
|
Hopf.1 | 61% | +13B +63B -113B | +115A | ||||||||
Chain A Sequence |
SATSLTFQLAYLVKKIDFDYTPNWGRGTPSSYIDNLTFPKVLTDKKYSYRVVVNGSDLGVESNFAVTPSGGQTINFLQYNKGYGVADTKTIQVFVVIPDTGNSEEYIIAEWKKT |
Chain A Sequence |
SATSLTFQLAYLVKKIDFDYTPNWGRGTPSSYIDNLTFPKVLTDKKYSYRVVVNGSDLGVESNFAVTPSGGQTINFLQYNKGYGVADTKTIQVFVVIPDTGNSEEYIIAEWK |
| sequence length | 114,112 |
| structure length | 114,112 |
| publication title |
A 1.7A structure of Fve, a member of the new fungal
immunomodulatory protein family
pubmed doi rcsb |
| molecule tags | Sugar binding protein, immune system |
| molecule keywords | IMMUNOMODULATORY PROTEIN FIP-FVE |
| pdb deposition date | 2003-03-20 |
| LinkProt deposition date | 2016-10-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF09259 | Fve | Fungal immunomodulatory protein Fve |
| AB | PF09259 | Fve | Fungal immunomodulatory protein Fve |
Image from the rcsb pdb (www.rcsb.org)#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
