Link type | Probability | Chain C piercings | Chain D piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C | ||||||||
view details |
![]() |
Hopf.2 | 62% | -62D | -9C -70C +87C |
Chain C Sequence |
MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEVLQ |
Chain C Sequence |
MVQQKVEVRLKTGLQARPAALFVQEANRFTSDVFLEKDGKKVNAKSIMGLMSLAVSTGTEVTLIAQGEDEQEALEKLAAYVQEEVLQ |
sequence length | 87,87 |
structure length | 87,87 |
publication title |
Crystal Structure at 1.8 A of the Bacillus Subtil Catabolite Bacillus Subtilis Catabolite Repression Containing Protein (Crh)
Reveals an Unexpected Swapping Domain as an Untertwinned Dimer
rcsb |
molecule tags | Transport protein |
molecule keywords | Hpr-like protein crh |
source organism | Bacillus subtilis |
pdb deposition date | 2002-09-06 |
LinkProt deposition date | 2016-10-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
CD | PF00381 | PTS-HPr | PTS HPr component phosphorylation site |
CD | PF00381 | PTS-HPr | PTS HPr component phosphorylation site |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Histidine-containing Protein; Chain: A; | Histidine-containing Protein; Chain: A; | ||
Alpha Beta | 2-Layer Sandwich | Histidine-containing Protein; Chain: A; | Histidine-containing Protein; Chain: A; |
#chains in the LinkProt database with same CATH superfamily 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC; #chains in the LinkProt database with same CATH topology 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC; #chains in the LinkProt database with same CATH homology 1MO1 BCD; 1MO1 ABD; 1MO1 ACD; 1MO1 ABC; 1MU4 AB; 1MO1 CD; 1MO1 ABCD; 1MO1 BD; 2AK7 AB; 1MO1 AB; 1MO1 AC;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...