| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 | 66% | -96B | -73A -97A +124A | ||||||||
| view details |
|
Hopf.2 | 66% | -96B | -73A -97A +124A | ||||||||
| view details |
|
Hopf.2 | 66% | -96B | -73A -97A +124A | ||||||||
| view details |
|
Hopf.2 | 66% | -96B | -73A -97A +124A | ||||||||
| view details |
|
Hopf.2 | 66% | -96B | -73A -97A +124A | ||||||||
| view details |
|
Hopf.2 | 66% | -96B | -73A -97A +124A | ||||||||
| view details |
|
Hopf.2 | 66% | -96B | -73A -97A +124A | ||||||||
| view details |
|
Hopf.2 | 66% | -96B | -73A -97A +124A | ||||||||
Chain A Sequence |
MQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLS |
Chain A Sequence |
MQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLS |
| sequence length | 112,112 |
| structure length | 112,112 |
| publication title |
Crystal structure of the FHA domain of the Chfr mitotic checkpoint protein and its complex with tungstate.
pubmed doi rcsb |
| molecule tags | Cell cycle |
| molecule keywords | cell cycle checkpoint protein CHFR |
| source organism | Homo sapiens |
| pdb deposition date | 2002-04-16 |
| LinkProt deposition date | 2016-10-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00498 | FHA | FHA domain |
| AB | PF00498 | FHA | FHA domain |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Tumour Suppressor Smad4 | Tumour Suppressor Smad4 | ||
| Mainly Beta | Sandwich | Tumour Suppressor Smad4 | Tumour Suppressor Smad4 |
#chains in the LinkProt database with same CATH superfamily 1LGQ AB; #chains in the LinkProt database with same CATH topology 1LGQ AB; #chains in the LinkProt database with same CATH homology 1LGQ AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
