| Link type | Probability | Chain A piercings | Chain B piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
| view details |
|
Hopf.1 U Ring | 20% | +125B +139B -209B +208C | ||||||||||
Chain A Sequence |
VHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE |
Chain A Sequence |
VHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE |
Chain A Sequence |
YVHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE |
| sequence length | 170,170,171 |
| structure length | 170,170,171 |
| publication title |
A New Crystal Form of the Nk1 Splice Variant of Hgf/Sf Demonstrates Extensive Hinge Movement and Suggests that the Nk1 Dimer Originates by Domain Swapping
pubmed doi rcsb |
| molecule tags | Hormone/growth factor |
| molecule keywords | HEPATOCYTE GROWTH FACTOR |
| source organism | Homo sapiens |
| pdb deposition date | 2001-10-31 |
| LinkProt deposition date | 2016-10-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| ABC | PF00024 | PAN_1 | PAN domain |
| ABC | PF00051 | Kringle | Kringle domain |
| ABC | PF00024 | PAN_1 | PAN domain |
| ABC | PF00051 | Kringle | Kringle domain |
| ABC | PF00024 | PAN_1 | PAN domain |
| ABC | PF00051 | Kringle | Kringle domain |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | Plasminogen Kringle 4 | Plasminogen Kringle 4 | ||
| Alpha Beta | 3-Layer(bba) Sandwich | Hepatocyte Growth Factor | Hepatocyte Growth Factor | ||
| Mainly Beta | Beta Barrel | Plasminogen Kringle 4 | Plasminogen Kringle 4 | ||
| Alpha Beta | 3-Layer(bba) Sandwich | Hepatocyte Growth Factor | Hepatocyte Growth Factor | ||
| Mainly Beta | Beta Barrel | Plasminogen Kringle 4 | Plasminogen Kringle 4 | ||
| Alpha Beta | 3-Layer(bba) Sandwich | Hepatocyte Growth Factor | Hepatocyte Growth Factor |
#chains in the LinkProt database with same CATH superfamily 1GP9 ABC; 1GP9 ACD; 1GP9 ABCD; 1GP9 CD; 1GP9 AC; 1GP9 AB; #chains in the LinkProt database with same CATH topology 1GP9 ABC; 1GP9 ACD; 1GP9 ABCD; 1GP9 CD; 1GP9 AC; 1GP9 AB; #chains in the LinkProt database with same CATH homology 1GP9 ABC; 1GP9 ACD; 1GP9 ABCD; 1GP9 CD; 1GP9 AC; 1GP9 AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...