| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
| view details |
|
Hopf.1 | 52% | -51B +80B +157B | +4A +42A -52A +66A +103A -157A -157A | ||||||||
Chain A Sequence |
MLLTGKLYKEEKQKFYDAQNGKCLICQRELNPDVQANHLDHDHELNGPKAGKVRGLLCNLCNAAEGQMKHKFNRSGLKGQGVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK |
Chain A Sequence |
MLLTGKLYKEEKQKFYDAQNGKCLICQRELNPDVQANHLDHDHELNGPKAGKVRGLLCNLCNAAEGQMKHKFNRSGLKGQGVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK |
| sequence length | 157,157 |
| structure length | 157,157 |
| publication title |
Conformational Flexibility in T4 Endonuclease Vii Revealed by Crystallography: Implications for Substrate Binding and Cleavage
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | RECOMBINATION ENDONUCLEASE VII |
| source organism | Bacteriophage t4 |
| ec nomenclature |
ec 3.1.22.4: Crossover junction endodeoxyribonuclease. ec 3.1.22.4: Crossover junction endodeoxyribonuclease. |
| pdb deposition date | 2000-08-28 |
| LinkProt deposition date | 2016-10-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF02945 | Endonuclease_7 | Recombination endonuclease VII |
| AB | PF09124 | Endonuc-dimeris | T4 recombination endonuclease VII, dimerisation |
| AB | PF02945 | Endonuclease_7 | Recombination endonuclease VII |
| AB | PF09124 | Endonuc-dimeris | T4 recombination endonuclease VII, dimerisation |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | His-Me finger endonuclease fold | His-Me finger endonucleases | ||
| Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | His-Me finger endonuclease fold | His-Me finger endonucleases |
#chains in the LinkProt database with same CATH superfamily 1E7D AB; 1EN7 AB; 1E7L AB; #chains in the LinkProt database with same CATH topology 1E7D AB; 1EN7 AB; 1E7L AB; #chains in the LinkProt database with same CATH homology 1E7D AB; 1EN7 AB; 1E7L AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
