Link type | Probability | Chain B piercings | Chain C piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Unlink | 71% | +62C -80C | |||||||||
view details |
![]() |
Unlink | 71% | +62C -80C | |||||||||
view details |
![]() |
Unlink | 71% | +62C -80C | |||||||||
view details |
![]() |
Unlink | 71% | +62C -80C | |||||||||
view details |
![]() |
Unlink | 71% | +62C -80C | |||||||||
view details |
![]() |
Unlink | 71% | +62C -80C |
Chain B Sequence |
AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
Chain B Sequence |
AHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK |
sequence length | 78,78 |
structure length | 78,78 |
publication title |
Human CksHs2 atomic structure: a role for its hexameric assembly in cell cycle control.
pubmed rcsb |
molecule tags | Cell division |
molecule keywords | CYCLIN-DEPENDENT KINASE SUBUNIT, TYPE 2 |
source organism | Homo sapiens |
pdb deposition date | 1993-09-16 |
LinkProt deposition date | 2016-10-21 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
BC | PF01111 | CKS | Cyclin-dependent kinase regulatory subunit |
BC | PF01111 | CKS | Cyclin-dependent kinase regulatory subunit |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Cyclin-Dependent Kinase Subunit Type 2 | Cell cycle regulatory proteins | ||
Alpha Beta | 2-Layer Sandwich | Cyclin-Dependent Kinase Subunit Type 2 | Cell cycle regulatory proteins |
#chains in the LinkProt database with same CATH superfamily 1CKS ABC; 1CKS BC; 1CKS AB; 1QB3 BC; 1CKS AC; 1QB3 AC; 1QB3 ABC; #chains in the LinkProt database with same CATH topology 1CKS ABC; 1CKS BC; 1CKS AB; 1QB3 BC; 1CKS AC; 1QB3 AC; 1QB3 ABC; #chains in the LinkProt database with same CATH homology 1CKS ABC; 1CKS BC; 1CKS AB; 1QB3 BC; 1CKS AC; 1QB3 AC; 1QB3 ABC;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...