| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 62% | -8B +66B | +54A -66A | ||||||||
| view details |
|
Unlink | 62% | -8B +66B | +54A -66A | ||||||||
| view details |
|
Unlink | 62% | -8B +66B | +54A -66A | ||||||||
| view details |
|
Unlink | 62% | -8B +66B | +54A -66A | ||||||||
| view details |
|
Unlink | 62% | -8B +66B | +54A -66A | ||||||||
| view details |
|
Unlink | 62% | -8B +66B | +54A -66A | ||||||||
| view details |
|
Unlink | 62% | -8B +66B | +54A -66A | ||||||||
| view details |
|
Unlink | 62% | -8B +66B | +54A -66A | ||||||||
Chain A Sequence |
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE |
Chain A Sequence |
KKYAKSKYDFVARNSSELSVMKDDVLEILDDRRQWWKVRNASGDSGFVPNNILDIMRTPE |
| sequence length | 60,60 |
| structure length | 60,60 |
| publication title |
The SH3 domain of Eps8 exists as a novel intertwined dimer.
pubmed doi rcsb |
| molecule tags | Signal transduction |
| molecule keywords | EPS8 |
| source organism | Mus musculus |
| pdb deposition date | 1997-07-07 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00018 | SH3_1 | SH3 domain |
| AB | PF00018 | SH3_1 | SH3 domain |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | SH3 type barrels. | SH3 Domains | ||
| Mainly Beta | Roll | SH3 type barrels. | SH3 Domains |
#chains in the LinkProt database with same CATH superfamily 1OV3 AD; 1OV3 BCD; 1OV3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 1OV3 AC; 1OV3 AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB; #chains in the LinkProt database with same CATH topology 1OV3 AD; 1OV3 BCD; 2HL3 BC; 1OV3 ABC; 3H6Z BM; 2HL3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 2HL3 AC; 2HL3 AB; 1OV3 AC; 1OV3 AB; 3H6Z AL; 2HKN AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB; #chains in the LinkProt database with same CATH homology 1OV3 AD; 1OV3 BCD; 1OV3 ABC; 1OV3 BC; 1OV3 BD; 1OV3 ACD; 1OV3 AC; 1OV3 AB; 1OV3 ABCD; 1OV3 ABD; 1AOJ AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
