2IBPAB

Crystal structure of citrate synthase from pyrobaculum aerophilum
Link type Probability Loop ranges Chain A piercings Chain B piercings
view details
Hopf.1 Hopf.1 100% 19-394A, 19-394B +30B +30A
Interpreting sequences
Chain A Sequence
EQTVQVKTTGKILQSPCGPIIHGLEDVLIKSTSISDIDGEKGILWYRGYRIEELARLSTYEEVSYLILYGRLPTKRELEDYINRMKKYRELHPATVEVIRNLAKAHPMFALEAAVAAEGAYDEDNQKLIEALSVGRYKAEEKELAYRIAEKLVAKMPTIVAYHYRFSRGLEVVRPRDDLGHAANFLYMMFGREPDPLASRGIDLYLILHADHEVPASTFAAHVVASTLSDLYSSVAAAIAALKGPLHGGANEMAVRNYLEIGTPAKAKEIVEAATKPGGPKLMGVGHRVYKAYDPRAKIFKEFSRDYVAKFGDPQNLFAIASAIEQEVLSHPYFQQRKLYPNVDFWSGIAFYYMGIPYEYFTPIFAMSRVVGWVAHVLEYWENNRIFRPRACYIGPHDLQYIPLEQR
Chain B Sequence
EQTVQVKTTGKILQSPCGPIIHGLEDVLIKSTSISDIDGEKGILWYRGYRIEELARLSTYEEVSYLILYGRLPTKRELEDYINRMKKYRELHPATVEVIRNLAKAHPMFALEAAVAAEGAYDEDNQKLIEALSVGRYKAEEKELAYRIAEKLVAKMPTIVAYHYRFSRGLEVVRPRDDLGHAANFLYMMFGREPDPLASRGIDLYLILHADHEVPASTFAAHVVASTLSDLYSSVAAAIAALKGPLHGGANEMAVRNYLEIGTPAKAKEIVEAATKPGGPKLMGVGHRVYKAYDPRAKIFKEFSRDYVAKFGDPQNLFAIASAIEQEVLSHPYFQQRKLYPNVDFWSGIAFYYMGIPYEYFTPIFAMSRVVGWVAHVLEYWENNRIFRPRACYIGPHDLQYIPLEQR
sequence length 407,407
structure length 407,407
publication title Discovery of a thermophilic protein complex stabilized by topologically interlinked chains.
pubmed doi rcsb
molecule tags Transferase
molecule keywords Citrate synthase
source organism Pyrobaculum aerophilum
pdb deposition date2006-09-11
LinkProt deposition date2016-08-17
Image from the rcsb pdb (www.rcsb.org)

1IOMA 2IBPB 2IFCA 2IFCB 2IFCC 2IFCD 2R9EA 2R9EB 2R9EC 2R9ED 2P2WA 1AJ8A 1AJ8B 1VGMA 1VGMB 1A59A 4YBOA 4YBOB 4YBOC 4YBOD 1IXEA 1IXEB 1IXEC 1IXED 3TQGA 3TQGB 2R26A 2R26B 2R26C 2R26D 3O8JA 3O8JB 3O8JC 3O8JD 3O8JE 3O8JF 3O8JG 3O8JH 3O8JI 3O8JJ 1O7XA 1O7XB 1O7XC 1O7XD 1VGPA 2C6XA 2C6XB 2C6XC 2C6XD 1IOMA 2IBPA 2IFCA 2IFCB 2IFCC 2IFCD 2R9EA 2R9EB 2R9EC 2R9ED 2P2WA 1AJ8A 1AJ8B 1VGMA 1VGMB 1A59A 4YBOA 4YBOB 4YBOC 4YBOD 1IXEA 1IXEB 1IXEC 1IXED 3TQGA 3TQGB 2R26A 2R26B 2R26C 2R26D 3O8JA 3O8JB 3O8JC 3O8JD 3O8JE 3O8JF 3O8JG 3O8JH 3O8JI 3O8JJ 1O7XA 1O7XB 1O7XC 1O7XD 1VGPA 2C6XA 2C6XB 2C6XC 2C6XD
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1IOM_A;  2IBP_B;  2IFC_A;  2IFC_B;  2IFC_C;  2IFC_D;  2R9E_A;  2R9E_B;  2R9E_C;  2R9E_D;  2P2W_A;  1AJ8_A;  1AJ8_B;  1VGM_A;  1VGM_B;  1A59_A;  4YBO_A;  4YBO_B;  4YBO_C;  4YBO_D;  1IXE_A;  1IXE_B;  1IXE_C;  1IXE_D;  3TQG_A;  3TQG_B;  2R26_A;  2R26_B;  2R26_C;  2R26_D;  3O8J_A;  3O8J_B;  3O8J_C;  3O8J_D;  3O8J_E;  3O8J_F;  3O8J_G;  3O8J_H;  3O8J_I;  3O8J_J;  1O7X_A;  1O7X_B;  1O7X_C;  1O7X_D;  1VGP_A;  2C6X_A;  2C6X_B;  2C6X_C;  2C6X_D;  1IOM_A;  2IBP_A;  2IFC_A;  2IFC_B;  2IFC_C;  2IFC_D;  2R9E_A;  2R9E_B;  2R9E_C;  2R9E_D;  2P2W_A;  1AJ8_A;  1AJ8_B;  1VGM_A;  1VGM_B;  1A59_A;  4YBO_A;  4YBO_B;  4YBO_C;  4YBO_D;  1IXE_A;  1IXE_B;  1IXE_C;  1IXE_D;  3TQG_A;  3TQG_B;  2R26_A;  2R26_B;  2R26_C;  2R26_D;  3O8J_A;  3O8J_B;  3O8J_C;  3O8J_D;  3O8J_E;  3O8J_F;  3O8J_G;  3O8J_H;  3O8J_I;  3O8J_J;  1O7X_A;  1O7X_B;  1O7X_C;  1O7X_D;  1VGP_A;  2C6X_A;  2C6X_B;  2C6X_C;  2C6X_D; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling