3IYB13

Poliovirus early rna-release intermediate
Link type Probability Chain 1 piercings Chain 3 piercings
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
view details
Hopf.2 Hopf.2 39% +1113 -2203 -2323 -1171 -2921 +3031
Interpreting sequences
Chain 1 Sequence
QHRSRSESSIESFFARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY
Chain 1 Sequence
GLPVMNTPGSNQYLTADNFQSPCALPEFDVTPPIDIPGEVKNMMELAEIDTMIPFDLSATKKNTMEMYRVRLSDKPHTDDPILCLSLSPASDPRLSHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGADPPKKRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTIDDSFTEGGYISVFYQTRIVVPLSTPREMDILGFVSACNDFSVRLLRDTTHI
sequence length 235,231
structure length 235,231
publication title Catching a virus in the act of RNA release: a novel poliovirus uncoating intermediate characterized by cryo-electron microscopy.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords Genome polyprotein
source organism Human poliovirus 1 mahoney
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
ec 3.4.22.28: Picornain 3C.
ec 3.4.22.29: Picornain 2A.
ec 3.6.1.15: Nucleoside-triphosphate phosphatase.
ec 2.7.7.48: RNA-directed RNA polymerase.
ec 3.4.22.28: Picornain 3C.
ec 3.4.22.29: Picornain 2A.
ec 3.6.1.15: Nucleoside-triphosphate phosphatase.
pdb deposition date2009-07-21
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
13 PF00073 Rhvpicornavirus capsid protein
13 PF00073 Rhvpicornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling