3IV1ABC

Coiled-coil domain of tumor susceptibility gene 101
Link type Probability Chain A piercings Chain B piercings Chain C piercings
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
Interpreting sequences
Chain A Sequence
GSSLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEK
Chain A Sequence
GSSLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEK
Chain A Sequence
GSSLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEK
sequence length 78,78,78
structure length 78,78,78
publication title Coiled-Coil Domain of Human Tsg101
rcsb
molecule tags Hydrolase
molecule keywords Tumor susceptibility gene 101 protein
source organism Homo sapiens
pdb deposition date2009-08-31
LinkProt deposition date2016-08-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling