5QJ4ABCD

Pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of nudt5 in complex with z1827602749
B: 55-57 C: 55-57 D: 53-59
Link type Probability Loop ranges Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
view details
Other Other 54% -A +86B -209B -209B -203C -127D -207A
Interpreting sequences
Chain A Sequence
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHA
Chain A Sequence
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRK-QTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHAN
Chain A Sequence
QYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRK-QTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHA
Chain A Sequence
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTT-----ADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHAN
sequence length 194,195,193,195
structure length 194,194,192,190
publication title PanDDA analysis group deposition of models with modelled events (e.g. bound ligands)
rcsb
molecule tags Hydrolase
molecule keywords ADP-sugar pyrophosphatase
source organism Homo sapiens
missing residues B: 55-57 C: 55-57 D: 53-59
pdb deposition date2018-11-12
LinkProt deposition date2018-12-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling