3HDBAL

Crystal structure of aahiv, a metalloproteinase from venom of agkistrodon acutus
Link type Probability Chain A piercings Chain L piercings
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
view details
Unlink Unlink 66% -258A +298A
Interpreting sequences
Chain A Sequence
YDPFKYVETVFVVDKAMVTKYNGDLDKIKTKMYEAANNMNEMYRYMFFRVVMVGLIIWTEEDKITVKPDVDYTLNAFAEWRKTYLLAEKKHDNAQLITGIDFRGSIIGYAYIGSMCHPKRSVGIIQDYSPINLVLAVIMAHEMGHNLGIHHDDGYCYCGGYPCIMGPSISPEPSKFFSNCSYIQCWDFIMNHNPECIDNEPLGTDIISPPLCGNELLEVGEECDCGTPENCQNPCCDAATCKLKSGSQCGHGKCCEQCKFRTSGTECRASMSECDPAEHCTGQSSECPADVFHKNGEPCLDNYGYCYNGNCPIMYHQCYALFGADIYEAEDSCFESNKKGNYYGYCRKENGKKIPCASEDVKCGRLYCKDDSPGQNNPCKMFYSNDDEHKGMVLPGTKCADGKVCSNGHCVDVTTAY
Chain A Sequence
KNL
sequence length 417,3
structure length 417,3
publication title Structural basis of the autolysis of AaHIV suggests a novel target recognizing model for ADAM/reprolysin family proteins
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AAHIV
ec nomenclature ec 3.4.24.-:
pdb deposition date2009-05-07
LinkProt deposition date2016-08-17
Image from the rcsb pdb (www.rcsb.org)

2DW0A 2DW0B 3K7NA 2EROA 2EROB 3K7LA 2DW1A 2DW1B 2DW2A 2DW2B 2ERQA 2ERQB 3DSLA 3DSLB 2ERPA 2ERPB 2E3XA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 2DW0_A;  2DW0_B;  3K7N_A;  2ERO_A;  2ERO_B;  3K7L_A;  2DW1_A;  2DW1_B;  2DW2_A;  2DW2_B;  2ERQ_A;  2ERQ_B;  3DSL_A;  3DSL_B;  2ERP_A;  2ERP_B;  2E3X_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling